CXCL3/GRO Gamma Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CXCL3/GRO Gamma Polyclonal antibody, PBS Only (11221-1-PBS)

• 

  WB analysis using 11221-1-AP (same clone as 11221-1-PBS)

  Non-treated, LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 11221-1-AP (CXCL3/GRO Gamma antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11221-1-PBS in a different storage buffer formulation.

CXCL3/GRO Gamma Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11221-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11221-1-PBS targets CXCL3/GRO Gamma in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1732

  Product name: Recombinant human CXCL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of BC016308

  Sequence: MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

• Full Name: chemokine (C-X-C motif) ligand 3
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 8-10 kDa
• GenBank Accession Number: BC016308
• Gene Symbol: CXCL3
• Gene ID (NCBI): 2921
• RRID: AB_3669124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19876
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression.