CXCL7/PPBP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CXCL7/PPBP Polyclonal antibody (33296-1-AP)

• 

  WB analysis using 33296-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33296-1-AP (CXCL7/PPBP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse placenta using 33296-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 33296-1-AP (PPBP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse placenta using 33296-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 33296-1-AP (PPBP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CXCL7/PPBP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33296-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Chemokine subfamily B Cys-X-Cys Platelet basic protein Thymus chemokine 1, Cxcl7, Ppbp

---

Tested Applications

• Positive WB detected in: mouse serum, mouse spleen tissue
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33296-1-AP targets CXCL7/PPBP in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2806

  Product name: Recombinant Mouse CXCL7/PPBP protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 48-109 aa of NM_023785.3

  Sequence: IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI

• Full Name: pro-platelet basic protein
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: NM_023785.3
• Gene Symbol: Ppbp
• Gene ID (NCBI): 57349
• RRID: AB_3742932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9EQI5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPBP, slso named as NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.