Mouse CXCR2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85144-5-RR (same clone as 85144-5-PBS)

  Rat liver tissue was subjected to SDS PAGE followed by western blot with 85144-5-RR (CXCR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85144-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 85144-5-RR (same clone as 85144-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 85144-5-RR (CXCR2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85144-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 85144-5-RR (same clone as 85144-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 85144-5-RR (CXCR2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85144-5-PBS in a different storage buffer formulation.

CXCR2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85144-5-PBS

Clone No.242766H6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242766H6, CD182, Cmkar2, C-X-C chemokine receptor type 2, CXC-R2

---

Product Information

85144-5-PBS targets CXCR2 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2228

  Product name: Recombinant Mouse CXCR2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 1-47 aa of NM_009909.3

  Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS

• Full Name: interleukin 8 receptor, beta
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_009909.3
• Gene Symbol: Cxcr2
• Gene ID (NCBI): 12765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35343
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CXCR2, also named as Cmkar2, Gpcr16, Il8rb or CD182, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.