Tested Applications
| Positive WB detected in | A549 cells, HL-60 cells, HeLa cells, Jurkat cells, K-562 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
34316-1-AP targets CXCR4/CD184 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Eg1985 Product name: recombinant human CXCR4/CD184 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-38 aa of NM_003467.3 Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNK Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 4 |
| Calculated Molecular Weight | 40kDa |
| Observed Molecular Weight | 80-85 kDa |
| GenBank Accession Number | NM_003467.3 |
| Gene Symbol | CXCR4 |
| Gene ID (NCBI) | 7852 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P61073-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C-X-C chemokine receptor type 4 (CXCR4, CD184) is a member of the Class A (rhodopsin-like) G protein-coupled receptor (GPCR) family and serves as the primary receptor for CXCL12, also known as stromal cell-derived factor-1 (SDF-1). As one of the most extensively studied chemokine receptors, CXCR4 plays a central role in regulating cell migration, tissue homing, immune surveillance, embryonic development, hematopoiesis, and stem cell maintenance. Upon binding CXCL12, CXCR4 activates multiple intracellular signaling pathways, including PI3K/AKT, MAPK/ERK, JAK/STAT, PLC/PKC, and Rho GTPase signaling, thereby controlling cell survival, proliferation, chemotaxis, cytoskeletal remodeling, and adhesion. Importantly, CXCR4 is recognized as one of the two principal co-receptors utilized by human immunodeficiency virus type 1 (HIV-1) for host cell entry. X4-tropic HIV-1 strains exploit CXCR4 together with CD4 to infect target T cells, making CXCR4 a longstanding focus of antiviral research.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CXCR4/CD184 antibody 34316-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

