Cytochrome b5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cytochrome b5 Polyclonal antibody (12365-1-AP)

Cytochrome b5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12365-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CYB5, CYB5A, Cytochrome b5, MCB5

• 

  WB analysis of human liver using 12365-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12365-1-AP (CYB5A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12365-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12365-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12365-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12365-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12365-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12365-1-AP (CYB5A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cytochrome b5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue
• Positive IHC detected in: human liver cancer tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12365-1-AP targets Cytochrome b5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3038

  Product name: Recombinant human Cytochrome b5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC015182

  Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSS

• Full Name: cytochrome b5 type A (microsomal)
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC015182
• Gene Symbol: Cytochrome b5
• Gene ID (NCBI): 1528
• RRID: AB_2089808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00167
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Cytochrome b5 Polyclonal antibody (Cat# 12365-1-AP) has 3 total citations. These appear in Proteomics Clinical Applications, International Journal of Women's Health, and Human Mutation. The associated research fields include ureteropelvic junction obstruction and extracellular matrix dysregulation, breast cancer prognostic stratification and cancer stem cell metabolism, and xenobiotic metabolism in liver cirrhosis-to-hepatocellular carcinoma progression.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Proteomics Clin Appl; Quantitative Proteome of Infant Stenotic Ureters Reveals Extracellular Matrix Organization and Oxidative Stress Dysregulation Underlying Ureteropelvic Junction Obstruction.; Authors - Yueyan Li
		Int J Womens Health; Novel Perspective for Prognostic Stratification and Personalized Therapy in Breast Cancer Patients: Development of Cancer Stem Cells and Metabolism-Associated Prognostic Model.; Authors - Wanjun Li
human	WB	Hum Mutat; Integrated Bulk and Single-Cell Transcriptomic Analysis Reveals Xenobiotic Metabolism Genes Drive Progression From Liver Cirrhosis to Hepatocellular Carcinoma.; Authors - Hao Xu