Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CYB5B Polyclonal antibody

CYB5B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

OMB5, Cytochrome b5 type B, CYPB5M, CYB5M, CYB5 M

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CYB5B in ?

Tested Applications

Positive WB detected inHepG2 cells, mouse liver tissue, human liver tissue, mouse lung tissue, human adrenal gland tissue, rat liver tissue, rat lung tissue
Positive IP detected inmouse lung tissue
Positive IHC detected inhuman testis tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15469-1-AP targets CYB5B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7771

Product name: Recombinant human CYB5B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-110 aa of BC004373

Sequence: MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS

Predict reactive species
Full Name cytochrome b5 type B (outer mitochondrial membrane)
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 20-21 kDa
GenBank Accession NumberBC004373
Gene Symbol CYB5B
Gene ID (NCBI) 80777
RRIDAB_2230349
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43169
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYB5B(Cytochrome b5 type B) is also named as CYB5M, OMB5 and belongs to the cytochrome b5 family. It is a 21 kDa membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. This protein is expressed on the plasma membrane of lymphoma cells but not normal lymphocytes, reactive lymphocytes or bone marrow precursor cells(PMID:20100355). The full length protein has a propeptide with 11 amino acids.

Protocols

Product Specific Protocols
IF protocol for CYB5B antibody 15469-1-APDownload protocol
IHC protocol for CYB5B antibody 15469-1-APDownload protocol
IP protocol for CYB5B antibody 15469-1-APDownload protocol
WB protocol for CYB5B antibody 15469-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CYB5B Polyclonal antibody (Cat# 15469-1-AP) has 7 total citations published in Cell Chem Biol, Cell Reports, J Cell Biology, Frontiers in Molecular Biosciences, J Biological Chemistry, PLoS Genetics, and Oral Diseases. Research fields span cholesterol biosynthesis and sterol oxidation, atherosclerosis, head and neck squamous cell carcinoma prognosis, mTORC1 signaling, cysteine acylation in the proteome, mitochondrial function, and LPS-induced mitochondrial dysfunction.

SpeciesApplicationTitle
humanWB

Cell Chem Biol

Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190.

Authors - Paige Dickson
  • KD Validated
human,mouseWB

Cell Rep

Defects in CYB5A and CYB5B impact sterol-C4 oxidation in cholesterol biosynthesis and demonstrate regulatory roles of dimethyl sterols

Authors - Mei-Yan Ma
humanWB

J Cell Biol

Mechanosensitive super-enhancers regulate genes linked to atherosclerosis in endothelial cells

Authors - Jin Li
humanIHC

Front Mol Biosci

Comprehensive Analysis of mTORC1 Signaling Pathway-Related Genes in the Prognosis of HNSCC and the Response to Chemotherapy and Immunotherapy.

Authors - Zhao Ding
humanWB

J Biol Chem

Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome

Authors - Hana Nůsková
mouseWB

PLoS Genet

Divergent role of Mitochondrial Amidoxime Reducing Component 1 (MARC1) in human and mouse

Authors - Eriks Smagris
Loading...
||
New chat

Able™

正在加载,请稍候...