CYC1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CYC1 Recombinant monoclonal antibody, PBS Only (87841-1-PBS)

CYC1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87841-1-PBS

Clone No.253398C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Cytochrome b-c1 complex subunit 4, Cytochrome c-1, EC:7.1.1.8, Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit, UQCR4

• 

  WB analysis using 87841-1-RR (same clone as 87841-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87841-1-RR (CYC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87841-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 87841-1-RR (same clone as 87841-1-PBS)

  WB result of CYC1 antibody (87841-1-RR; 1:400000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CYC1 transfected PC-3 cells. This data was developed using the same antibody clone with 87841-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87841-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87841-1-RR against Human CYC1 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87841-1-PBS targets CYC1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0291

  Product name: Recombinant human CYC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-271 aa of BC001006

  Sequence: ALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVC

• Full Name: cytochrome c-1
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC001006
• Gene Symbol: CYC1
• Gene ID (NCBI): 1537
• RRID: AB_3745782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08574
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYC1, also named as Cytochrome c-1, belongs to the cytochrome c family. Cytochrome c1 is one respiratory subunit of the 11 subunits of the cytochrome bc1 complex of the mitochondrial electron-transfer chain. It mediates the transfer of an electron from Rieske iron-sulfur protein to cytochrome c(PMID:3036122 ). CYC1 mediates apoptosis. In this pathway, a variety of apoptotic stimuli cause CYC1 release from mitochondria, which in turn induces a series of biochemical reactions that result incaspase activation and subsequent cell death.(PMID:15189137) While CYC1 release and DNA fragmentation are unaffected by the noncleavablep75 mutant, mitochondrial morphology of dying cells is maintained, and loss of plasma membrane integrity is delayed(PMID:15186778).