CYP1A1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CYP1A1 Recombinant monoclonal antibody, PBS Only (88462-1-PBS)

CYP1A1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88462-1-PBS

Clone No.261000F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

AHH, AHRR, CP11, CYP1, CYPIA1

• 

  WB analysis of mouse liver using 88462-1-RR (same clone as 88462-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 88462-1-RR (CYP1A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88462-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 88462-1-RR

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 88462-1-RR (CYP1A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 88462-1-RR (same clone as 88462-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 88462-1-RR (CYP1A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88462-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88462-1-PBS targets CYP1A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3990

  Product name: Recombinant human CYP1A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-465 aa of BC023019

  Sequence: ISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARW

• Full Name: cytochrome P450, family 1, subfamily A, polypeptide 1
• Calculated Molecular Weight: 512 aa, 58 kDa
• Observed Molecular Weight: 50-58 kDa
• GenBank Accession Number: BC023019
• Gene Symbol: CYP1A1
• Gene ID (NCBI): 1543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04798
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYP1A1 is a phase I xenobiotic-metabolizing enzyme that bioactivates environmental procarcinogens, particularly polycyclic aromatic hydrocarbons (PAHs), into reactive intermediates that can initiate carcinogenesis. Its expression is primarily regulated at the transcriptional level by the aryl hydrocarbon receptor (AHR), which upon ligand binding induces CYP1A1 via xenobiotic response elements. Genetic polymorphisms in the human CYP1A1 gene have been linked to increased susceptibility to lung and other cancers.