CYP21A2 Monoclonal antibody, PBS Only

Name: CYP21A2 Monoclonal antibody, PBS Only,
Brand: Proteintech

CYP21A2 Monoclonal Antibody for Indirect ELISA

Cat No. 67421-2-PBS

Clone No. 1D5A6

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Indirect ELISA

Synonyms

CA21H, CAH1, CPS1, CYP21, CYP21B

Formulation: PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllAffinity

Affinity and Kinetic Characterization of 67421-2-PBS
Biolayer interferometry (BLl) kinetic assay of 67421-2-Ig against Human CYP21A2 was performed. The affinity constant is 675 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP21A2 in ?

67421-2-PBS targets CYP21A2 in Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species
Full Name	cytochrome P450, family 21, subfamily A, polypeptide 2
Calculated Molecular Weight	56 kDa
GenBank Accession Number	NM_000500
Gene Symbol	CYP21A2
Gene ID (NCBI)	1589
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P08686
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.