Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CYP24A1 Polyclonal antibody

CYP24A1 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, ELISA

Cytochrome P450 24A1, CYP24, CP24, 24-OHase, 24 OHase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CYP24A1 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman kidney tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21582-1-AP targets CYP24A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16134

Product name: Recombinant human CYP24A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC109083

Sequence: MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ

Predict reactive species
Full Name cytochrome P450, family 24, subfamily A, polypeptide 1
Calculated Molecular Weight 514 aa, 59 kDa
Observed Molecular Weight 54-59 kDa
GenBank Accession NumberBC109083
Gene Symbol CYP24A1
Gene ID (NCBI) 1591
RRIDAB_10792804
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07973
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP24A1(1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and 1-alpha,25-dihydroxyvitamin D3. Cholecalciferol is metabolised by the 25-hydroxylases (CYP2R1 and CYP27A1) in the liver, before 25-hydroxycholecalciferol (25(OH)D3) relocates to the circulation (PMID:20362668). The gene CYP24A1 has three isoforms, for the transit peptide "mitochondrial domain" removed, the MW of CYP24A1 will be 55-59 kDa, 47-51 kDa and 43 kDa. This antibody is specific to CYP24A1.

Protocols

Product Specific Protocols
IHC protocol for CYP24A1 antibody 21582-1-APDownload protocol
IP protocol for CYP24A1 antibody 21582-1-APDownload protocol
WB protocol for CYP24A1 antibody 21582-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CYP24A1 Polyclonal antibody (Cat# 21582-1-AP) has accumulated 23 citations across journals including Cancer Communications, Cancer Letters, Metabolism, iScience, FASEB Journal, Scientific Reports, International Immunopharmacology, Journal of Bone and Mineral Research, Acta Physiologica, Cancer Science, Burns & Trauma, Journal of Nutritional Biochemistry, Chemistry & Biology Interactions, Journal of Physiology, American Journal of Physiology, Pflugers Archive, Journal of Steroid Biochemistry, PLoS ONE, Translational Cancer Research, Current Medical Science, and Toxicology & Applied Pharmacology. Research fields encompass oncology, vitamin D metabolism, bone/mineral homeostasis, fibrosis, inflammation, wound healing, and renal physiology.

SpeciesApplicationTitle
humanWB

Cancer Commun (Lond)

Squalene epoxidase promotes colorectal cancer cell proliferation through accumulating calcitriol and activating CYP24A1-mediated MAPK signaling.

Authors - Luwei He
ratIHC

Metabolism

1,25-Dihydroxyvitamin D3 protects against placental inflammation by suppressing NLRP3-mediated IL-1β production via Nrf2 signaling pathway in preeclampsia

Authors - Xueqing Liu
humanWB,IHC

Cancer Lett

TAZ regulates cell proliferation and sensitivity to vitamin D3 in intrahepatic cholangiocarcinoma.

Authors - Heng Xiao
  • KD Validated
humanIHC

Burns Trauma

CYP24A1 is overexpressed in keloid keratinocytes and its inhibition alters profibrotic gene expression

Authors - Jennifer M Hahn
mouseWB

J Bone Miner Res

Exercise May Ameliorate the Detrimental Side Effects of High Vitamin D Supplementation on Muscle Function in Mice.

Authors - Danielle A Debruin
mouseWB

Acta Physiol (Oxf)

Intestinal epithelial ablation of Pit-2/Slc20a2 in mice leads to sustained elevation of vitamin D3 upon dietary restriction of phosphate.

Authors - Eva Maria Pastor-Arroyo

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user rated this antibody 5 out of 5 stars. Kenzo Oikawa used it for immunofluorescence on mouse kidney tissue at a 1:100 dilution (Lot 00077104) and reported that it "appeared to work pretty well." Overall, the single review reflects a positive experience with strong performance in IF applications on mouse tissue.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kenzo (Verified Customer) (08-30-2023)

This antibody appeared to work pretty well for immunofluorescence in mouse tissues.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Kidney
Loading...
||
New chat

Able™

正在加载,请稍候...