Tested Applications
| Positive WB detected in | A549 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human kidney tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21582-1-AP targets CYP24A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16134 Product name: Recombinant human CYP24A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC109083 Sequence: MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ Predict reactive species |
| Full Name | cytochrome P450, family 24, subfamily A, polypeptide 1 |
| Calculated Molecular Weight | 514 aa, 59 kDa |
| Observed Molecular Weight | 54-59 kDa |
| GenBank Accession Number | BC109083 |
| Gene Symbol | CYP24A1 |
| Gene ID (NCBI) | 1591 |
| RRID | AB_10792804 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07973 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CYP24A1(1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and 1-alpha,25-dihydroxyvitamin D3. Cholecalciferol is metabolised by the 25-hydroxylases (CYP2R1 and CYP27A1) in the liver, before 25-hydroxycholecalciferol (25(OH)D3) relocates to the circulation (PMID:20362668). The gene CYP24A1 has three isoforms, for the transit peptide "mitochondrial domain" removed, the MW of CYP24A1 will be 55-59 kDa, 47-51 kDa and 43 kDa. This antibody is specific to CYP24A1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CYP24A1 antibody 21582-1-AP | Download protocol |
| IP protocol for CYP24A1 antibody 21582-1-AP | Download protocol |
| WB protocol for CYP24A1 antibody 21582-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CYP24A1 Polyclonal antibody (Cat# 21582-1-AP) has accumulated 23 citations across journals including Cancer Communications, Cancer Letters, Metabolism, iScience, FASEB Journal, Scientific Reports, International Immunopharmacology, Journal of Bone and Mineral Research, Acta Physiologica, Cancer Science, Burns & Trauma, Journal of Nutritional Biochemistry, Chemistry & Biology Interactions, Journal of Physiology, American Journal of Physiology, Pflugers Archive, Journal of Steroid Biochemistry, PLoS ONE, Translational Cancer Research, Current Medical Science, and Toxicology & Applied Pharmacology. Research fields encompass oncology, vitamin D metabolism, bone/mineral homeostasis, fibrosis, inflammation, wound healing, and renal physiology.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) Squalene epoxidase promotes colorectal cancer cell proliferation through accumulating calcitriol and activating CYP24A1-mediated MAPK signaling. | ||
Metabolism 1,25-Dihydroxyvitamin D3 protects against placental inflammation by suppressing NLRP3-mediated IL-1β production via Nrf2 signaling pathway in preeclampsia | ||
Cancer Lett TAZ regulates cell proliferation and sensitivity to vitamin D3 in intrahepatic cholangiocarcinoma.
| ||
Burns Trauma CYP24A1 is overexpressed in keloid keratinocytes and its inhibition alters profibrotic gene expression | ||
J Bone Miner Res Exercise May Ameliorate the Detrimental Side Effects of High Vitamin D Supplementation on Muscle Function in Mice. | ||
Acta Physiol (Oxf) Intestinal epithelial ablation of Pit-2/Slc20a2 in mice leads to sustained elevation of vitamin D3 upon dietary restriction of phosphate. |
Reviews
What customers say
One user rated this antibody 5 out of 5 stars. Kenzo Oikawa used it for immunofluorescence on mouse kidney tissue at a 1:100 dilution (Lot 00077104) and reported that it "appeared to work pretty well." Overall, the single review reflects a positive experience with strong performance in IF applications on mouse tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kenzo (Verified Customer) (08-30-2023) | This antibody appeared to work pretty well for immunofluorescence in mouse tissues.
|
