CYP24A1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84821-3-RR (same clone as 84821-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84821-3-RR (CYP24A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84821-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 84821-3-RR (same clone as 84821-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84821-3-RR (CYP24A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84821-3-PBS in a different storage buffer formulation.

CYP24A1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84821-3-PBS

Clone No.242142F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CYP24, CP24, 24-OHase, 242142F2, 24 OHase

---

Product Information

84821-3-PBS targets CYP24A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17089

  Product name: Recombinant human CYP24A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC109083

  Sequence: MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ

• Full Name: cytochrome P450, family 24, subfamily A, polypeptide 1
• Calculated Molecular Weight: 514 aa, 59 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC109083
• Gene Symbol: CYP24A1
• Gene ID (NCBI): 1591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q07973
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYP24A1(1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and 1-alpha,25-dihydroxyvitamin D3. Cholecalciferol is metabolized by the 25-hydroxylases (CYP2R1 and CYP27A1) in the liver before 25-hydroxycholecalciferol (25(OH)D3) relocates to the circulation (PMID:20362668). The gene CYP24A1 has three isoforms, for the transit peptide "mitochondrial domain" removed, the MW of CYP24A1 will be 55-59 kDa, 47-51 kDa, and 43 kDa. This antibody is specific to CYP24A1.