Tested Applications
| Positive WB detected in | human placenta tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84699-1-RR targets CYP26A1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24898 Product name: Recombinant human CYP26A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-220 aa of BC157063 Sequence: VHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRN Predict reactive species |
| Full Name | cytochrome P450, family 26, subfamily A, polypeptide 1 |
| Calculated Molecular Weight | 497 aa, 56 kDa |
| Observed Molecular Weight | 50-56 kDa |
| GenBank Accession Number | BC157063 |
| Gene Symbol | CYP26A1 |
| Gene ID (NCBI) | 1592 |
| RRID | AB_3672115 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O43174 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1), also known as Cytochrome P450 26A1, CP26, CYP26, P450RAI, and P450RAI1, is a member of the cytochrome P450 superfamily of enzymes, involved in retinoic acid (RA) metabolism and synthesis of cholesterol, steroids, and other lipids. CYP26A1 is essential for normal hindbrain patterning, vertebral identity, and development of posterior structures(PMID: 11157778).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CYP26A1 antibody 84699-1-RR | Download protocol |
| IF protocol for CYP26A1 antibody 84699-1-RR | Download protocol |
| IHC protocol for CYP26A1 antibody 84699-1-RR | Download protocol |
| WB protocol for CYP26A1 antibody 84699-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













