CYP26A1 Recombinant monoclonal antibody

• 

  WB analysis using 84699-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84699-1-RR (CYP26A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84699-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84699-1-RR (CYP26A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 84699-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84699-1-RR (CYP26A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 84699-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84699-1-RR (CYP26A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 84699-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CYP26A1 antibody (84699-1-RR, Clone: 241816D11 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HepG2 using 84699-1-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug CYP26A1 Recombinant antibody (84699-1-RR, Clone:241816D11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84699-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84699-1-RR against Human CYP26A1 were performed. The affinity constant is below 1 pM.

CYP26A1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 84699-1-RR

Clone No.241816D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

241816D11, CP26, CYP26, Cytochrome P450 26A1, Cytochrome P450RAI

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84699-1-RR targets CYP26A1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24898

  Product name: Recombinant human CYP26A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-220 aa of BC157063

  Sequence: VHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRN

• Full Name: cytochrome P450, family 26, subfamily A, polypeptide 1
• Calculated Molecular Weight: 497 aa, 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC157063
• Gene Symbol: CYP26A1
• Gene ID (NCBI): 1592
• RRID: AB_3672115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O43174
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1), also known as Cytochrome P450 26A1, CP26, CYP26, P450RAI, and P450RAI1, is a member of the cytochrome P450 superfamily of enzymes, involved in retinoic acid (RA) metabolism and synthesis of cholesterol, steroids, and other lipids. CYP26A1 is essential for normal hindbrain patterning, vertebral identity, and development of posterior structures(PMID: 11157778).