CYP26A1 Recombinant monoclonal antibody

CYP26A1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 84699-1-RR
Clone No.241816D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

241816D11, CP26, CYP26, Cytochrome P450 26A1, Cytochrome P450RAI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, mouse skeletal muscle tissue
Positive IHC detected inmouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84699-1-RR targets CYP26A1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24898

Product name: Recombinant human CYP26A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-220 aa of BC157063

Sequence: VHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRN

Predict reactive species
Full Name cytochrome P450, family 26, subfamily A, polypeptide 1
Calculated Molecular Weight 497 aa, 56 kDa
Observed Molecular Weight 50-56 kDa
GenBank Accession NumberBC157063
Gene Symbol CYP26A1
Gene ID (NCBI) 1592
RRIDAB_3672115
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO43174
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1), also known as Cytochrome P450 26A1, CP26, CYP26, P450RAI, and P450RAI1, is a member of the cytochrome P450 superfamily of enzymes, involved in retinoic acid (RA) metabolism and synthesis of cholesterol, steroids, and other lipids. CYP26A1 is essential for normal hindbrain patterning, vertebral identity, and development of posterior structures(PMID: 11157778).

Protocols

Product Specific Protocols
FC protocol for CYP26A1 antibody 84699-1-RRDownload protocol
IF protocol for CYP26A1 antibody 84699-1-RRDownload protocol
IHC protocol for CYP26A1 antibody 84699-1-RRDownload protocol
WB protocol for CYP26A1 antibody 84699-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...