CYP26A1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84699-1-RR (same clone as 84699-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84699-1-RR (CYP26A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84699-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 84699-1-RR (same clone as 84699-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84699-1-RR (CYP26A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84699-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 84699-1-RR (same clone as 84699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84699-1-RR (CYP26A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84699-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 84699-1-RR (same clone as 84699-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84699-1-RR (CYP26A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84699-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 84699-1-RR (same clone as 84699-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CYP26A1 antibody (84699-1-RR, Clone: 241816D11 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84699-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84699-1-RR (same clone as 84699-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug CYP26A1 Recombinant antibody (84699-1-RR, Clone:241816D11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84699-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84699-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84699-1-RR against Human CYP26A1 were performed. The affinity constant is below 1 pM.

CYP26A1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 84699-1-PBS

Clone No.241816D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

241816D11, CP26, CYP26, Cytochrome P450 26A1, Cytochrome P450RAI

---

Product Information

84699-1-PBS targets CYP26A1 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24898

  Product name: Recombinant human CYP26A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-220 aa of BC157063

  Sequence: VHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRN

• Full Name: cytochrome P450, family 26, subfamily A, polypeptide 1
• Calculated Molecular Weight: 497 aa, 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC157063
• Gene Symbol: CYP26A1
• Gene ID (NCBI): 1592
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O43174
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1), also known as Cytochrome P450 26A1, CP26, CYP26, P450RAI, and P450RAI1, is a member of the cytochrome P450 superfamily of enzymes, involved in retinoic acid (RA) metabolism and synthesis of cholesterol, steroids, and other lipids. CYP26A1 is essential for normal hindbrain patterning, vertebral identity, and development of posterior structures(PMID: 11157778).