CYP2C8/9/18/19 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYP2C8/9/18/19 Polyclonal antibody (16546-1-AP)

CYP2C8/9/18/19 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16546-1-AP Copied!

Publications (36)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CP2C8, CYP2C8, CPC8, CYPIIC8, Cytochrome P450 2C8

• 

  WB analysis using 16546-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16546-1-AP (CYP2C8/9/18/19 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16546-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16546-1-AP (CYP2C8/9/18/19 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16546-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16546-1-AP (CYP2C8/9/18/19 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP2C8/9/18/19 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16546-1-AP targets CYP2C8/9/18/19 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9898

  Product name: Recombinant human CYP2C8 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 142-490 aa of BC020596

  Sequence: EDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

• Full Name: cytochrome P450, family 2, subfamily C, polypeptide 8
• Calculated Molecular Weight: 490 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC020596
• Gene Symbol: CYP2C8
• Gene ID (NCBI): 1558
• RRID: AB_2089685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10632
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP2C8(Cytochrome P450 2C8) is also named as CYPIIC8, cytochrome P450 IIC2, cytochrome P450 MP-12, cytochrome P450 MP-20, cytochrome P450 form 1 and S-mephenytoin 4-hydroxylase. It belongs to the cytochrome P450 family. It is a monooxygenase involved in an NADPH-dependent electron transport pathway and a hepatic drug-metabolizing enzymes that oxidizes therapeutic drugs such as cerivastatin and endobiotics such as retinoic acid and arachidonic acid. It has 2 isoforms produced by alternative splicing. This antibody can recognize human CYP2C 8/9/18/19, mouse CYP2C 29/37/38/39/55/65/, rat CYP2C6/7/11/12/13/23 due to the high homology.

Publications

What published studies show

The anti-CYP2J2 antibody (Cat# 16546-1-AP) has 36 citations spanning journals including Nature Communications, Cell Chemical Biology, Journal of Medicinal Chemistry, Frontiers in Immunology, Pharmacological Research, and Xenobiotica. Research fields cover hepatocellular carcinoma, lipid metabolism, drug pharmacokinetics, neuroinflammation, pulmonary fibrosis, breast cancer, pancreatic cancer, placental biology, iron homeostasis, circadian gene regulation, and environmental toxicology. Applications are predominantly WB and IHC across human, mouse, rat, and other species.

Automatically generated from the 36 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Commun; Androgen receptor promotes arachidonic acid metabolism and angiogenic microenvironment in AFP-negative hepatocellular carcinoma; Authors - Zhilong Lin
rat	WB	J Neuroinflammation; DNA methylation regulation of CYP450-lipid metabolism by high-altitude hypoxia: linking neuroinflammation to cognitive impairment.; Authors - Qian Wang
human	WB	J Pharm Anal; Eight Zhes Decoction ameliorates the lipid dysfunction of nonalcoholic fatty liver disease using integrated lipidomics, network pharmacology and pharmacokinetics; Authors - Yuping Zhou
mouse	WB	Cell Chem Biol; 3D two-photon brain imaging reveals dihydroartemisinin exerts antiepileptic effects by modulating iron homeostasis.; Authors - Chenwen Shao
human	WB	J Med Chem; Gemfibrozil-Platinum(IV) Precursors for New Enhanced-Starvation and Chemotherapy In Vitro and In Vivo; Authors - Xue-Qing Song
human	IHC	Front Immunol; The interplay of inflammation and placenta in maternal diabetes: insights into Hofbauer cell expression patterns; Authors - Zdenek Tauber