CYP2C8/9/18/19 Polyclonal antibody

• 

  WB analysis using 16546-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16546-1-AP (CYP2C8/9/18/19 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 16546-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16546-1-AP (CYP2C8/9/18/19 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16546-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16546-1-AP (CYP2C8/9/18/19 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CYP2C8/9/18/19 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16546-1-AP

Publications(23)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CP2C8, CYP2C8, CPC8, CYPIIC8, Cytochrome P450 2C8

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 15 publications below
• IHC: See 8 publications below

Product Information

16546-1-AP targets CYP2C8/9/18/19 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9898

  Product name: Recombinant human CYP2C8 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 142-490 aa of BC020596

  Sequence: EDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

• Full Name: cytochrome P450, family 2, subfamily C, polypeptide 8
• Calculated Molecular Weight: 490 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC020596
• Gene Symbol: CYP2C8
• Gene ID (NCBI): 1558
• RRID: AB_2089685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10632
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP2C8(Cytochrome P450 2C8) is also named as CYPIIC8, cytochrome P450 IIC2, cytochrome P450 MP-12, cytochrome P450 MP-20, cytochrome P450 form 1 and S-mephenytoin 4-hydroxylase. It belongs to the cytochrome P450 family. It is a monooxygenase involved in an NADPH-dependent electron transport pathway and a hepatic drug-metabolizing enzymes that oxidizes therapeutic drugs such as cerivastatin and endobiotics such as retinoic acid and arachidonic acid. It has 2 isoforms produced by alternative splicing. This antibody can recognize human CYP2C 8/9/18/19, mouse CYP2C 29/37/38/39/55/65/, rat CYP2C6/7/11/12/13/23 due to the high homology.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Chem Biol; 3D two-photon brain imaging reveals dihydroartemisinin exerts antiepileptic effects by modulating iron homeostasis.; Authors - Chenwen Shao
human	WB	Front Oncol; Prognostic Value and Correlation With Tumor Immune Infiltration of a Novel Metabolism-Related Gene Signature in Pancreatic Cancer.; Authors - Hui Chen
human	IHC	Front Oncol; Novel Prognostic Signatures of Hepatocellular Carcinoma Based on Metabolic Pathway Phenotypes.; Authors - Tingbo Ye
human	WB	Pharmaceutics; Assessing CYP2C8-Mediated Pharmaceutical Excipient-Drug Interaction Potential: A Case Study of Tween 80 and Cremophor EL-35.; Authors - Chengming Wen
rat	WB	Front Pharmacol; Mechanism of Paeoniflorin on ANIT-Induced Cholestatic Liver Injury Using Integrated Metabolomics and Network Pharmacology.; Authors - Lisheng Chen
human	IHC	BMC Cancer; Elevated 14,15- epoxyeicosatrienoic acid by increasing of cytochrome P450 2C8, 2C9 and 2J2 and decreasing of soluble epoxide hydrolase associated with aggressiveness of human breast cancer.; Authors - Xiaolong Wei