CYP2C8 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85717-1-RR (same clone as 85717-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85717-1-RR (CYP2C8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85717-1-RR (same clone as 85717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85717-1-RR (CYP2C8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85717-1-RR (same clone as 85717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85717-1-RR (CYP2C8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85717-1-PBS in a different storage buffer formulation.

CYP2C8 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85717-1-PBS

Clone No.242948A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CP2C8, 242948A3, CPC8, CYP2C8/9/18/19, CYPIIC8

---

Product Information

85717-1-PBS targets CYP2C8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9898

  Product name: Recombinant human CYP2C8 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 142-490 aa of BC020596

  Sequence: EDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

• Full Name: cytochrome P450, family 2, subfamily C, polypeptide 8
• Calculated Molecular Weight: 490 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC020596
• Gene Symbol: CYP2C8
• Gene ID (NCBI): 1558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10632
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYP2C8(Cytochrome P450 2C8) is also named as CYPIIC8, cytochrome P450 IIC2, cytochrome P450 MP-12, cytochrome P450 MP-20, cytochrome P450 form 1 and S-mephenytoin 4-hydroxylase. It belongs to the cytochrome P450 family. It is a monooxygenase involved in an NADPH-dependent electron transport pathway and a hepatic drug-metabolizing enzymes that oxidizes therapeutic drugs such as cerivastatin and endobiotics such as retinoic acid and arachidonic acid. It has 2 isoforms produced by alternative splicing.