CYP2C8 Recombinant monoclonal antibody, PBS Only (Capture)

CYP2C8 Uni-rAb® Recombinant Antibody for IHC, Cytometric bead array, Indirect ELISA
Cat No. 85717-4-PBS
Clone No.242948D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Cytometric bead array, Indirect ELISA

CP2C8, CPC8, CYP2C8/9/18/19, CYPIIC8, Cytochrome P450 2C8

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85717-4-PBS targets CYP2C8 as part of a matched antibody pair:

MP02106-2: 85717-4-PBS capture and 85717-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9898

Product name: Recombinant human CYP2C8 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 142-490 aa of BC020596

Sequence: EDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

Predict reactive species
Full Name cytochrome P450, family 2, subfamily C, polypeptide 8
Calculated Molecular Weight 490 aa, 56 kDa
GenBank Accession NumberBC020596
Gene Symbol CYP2C8
Gene ID (NCBI) 1558
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10632
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...