CYP46A1 Monoclonal antibody, PBS Only

CYP46A1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68576-1-PBS
Clone No.1E10D3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat, Rabbit, Pig

Applications

WB, IHC, Indirect ELISA

CH24H, Cholesterol 24 hydroxylase, CP46, CYP46, CYP46A1, Cytochrome P450 46A1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68576-1-PBS targets CYP46A1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.

Tested Reactivity Human, Mouse, Rat, Rabbit, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16786

Product name: Recombinant human CYP46A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 201-500 aa of BC022539

Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC

Predict reactive species
Full Name cytochrome P450, family 46, subfamily A, polypeptide 1
Calculated Molecular Weight 500 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC022539
Gene Symbol CYP46A1
Gene ID (NCBI) 10858
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y6A2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cytochrome P450 46A1 (CYP46A1), also named as CYP46, P450 46A1, CH24H and Cholesterol 24-hydroxylase, belongs to the cytochrome P450 family. CYP46A1 is a central nervous system-specific enzyme, and can freely cross the blood-brain barrier and be degraded in the liver. It is involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. CYP46A1 is significantly upregulated in hepatic lymphomyeloid cells compared with ESCs.(PMID:20039312)

Loading...
||
New chat Able
正在加载,请稍候...