CYP46A1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CYP46A1 Recombinant monoclonal antibody, PBS Only (86957-1-PBS)

• 

  WB analysis using 86957-1-RR (same clone as 86957-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86957-1-RR (CYP46A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 86957-1-RR (same clone as 86957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 86957-1-RR (CYP46A1 antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 86957-1-RR (same clone as 86957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 86957-1-RR (CYP46A1 antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86957-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86957-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86957-1-RR against Human CYP46A1 were performed. The affinity constant is 6.95 nM.

CYP46A1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86957-1-PBS

Clone No.250155G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CH24H, Cholesterol 24 hydroxylase, Cholesterol 24-hydroxylase, Cholesterol 24-monooxygenase, Cholesterol 24S-hydroxylase

---

Product Information

86957-1-PBS targets CYP46A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16786

  Product name: Recombinant human CYP46A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 201-500 aa of BC022539

  Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC

• Full Name: cytochrome P450, family 46, subfamily A, polypeptide 1
• Calculated Molecular Weight: 500 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC022539
• Gene Symbol: CYP46A1
• Gene ID (NCBI): 10858
• RRID: AB_3745233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y6A2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytochrome P450 46A1 (CYP46A1), also named as CYP46, P450 46A1, CH24H and Cholesterol 24-hydroxylase, belongs to the cytochrome P450 family. CYP46A1 is a central nervous system-specific enzyme, and can freely cross the blood-brain barrier and be degraded in the liver. It is involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. CYP46A1 is significantly upregulated in hepatic lymphomyeloid cells compared with ESCs.(PMID:20039312)