Filter:
Tested Applications
| Positive IF/ICC detected in | MCF-7 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67656 targets CYR61/CCN1 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species |
| Full Name | cysteine-rich, angiogenic inducer, 61 |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 40-42 kDa |
| GenBank Accession Number | BC001271 |
| Gene Symbol | CYR61 |
| Gene ID (NCBI) | 3491 |
| RRID | AB_3084369 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00622 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 CYR61/CCN1 antibody CL488-67656 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
