• Featured Product
  • KD/KO Validated

Cytohesin 2 Polyclonal antibody

Cytohesin 2 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 10405-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IP, IF, IHC, ELISA

ARF exchange factor, ARNO, CTS18, CTS18.1, CYTH2, cytohesin 2, Protein ARNO, PSCD2, PSCD2L, SEC7L, Sec7p L, Sec7p like

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman colon tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10405-1-AP targets Cytohesin 2 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0687

Product name: Recombinant human CYTH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 130-384 aa of BC004361

Sequence: VDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEML

Predict reactive species
Full Name cytohesin 2
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC004361
Gene Symbol Cytohesin 2
Gene ID (NCBI) 9266
RRIDAB_2089028
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99418
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with small G proteins ARF1, ARF3, and ARF6.

Protocols

Product Specific Protocols
IHC protocol for Cytohesin 2 antibody 10405-1-APDownload protocol
IP protocol for Cytohesin 2 antibody 10405-1-APDownload protocol
WB protocol for Cytohesin 2 antibody 10405-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB, IF

J Neurosci

Inhibition of Cytohesins Protects against Genetic Models of Motor Neuron Disease.

Authors - Jinbin Zhai
mouseWB,IHC

J Biol Chem

The synaptic scaffolding protein CNKSR2 interacts with CYTH2 to mediate hippocampal granule cell development.

Authors - Hidenori Ito
  • KD Validated
humanWB

Oncol Rep

Cytohesin-2 as a novel prognostic marker for hepatocellular carcinoma.

Authors - Xu Kedong K
ratWB,IP

Open Biol

ARNO is recruited by the neuronal adaptor FE65 to potentiate ARF6-mediated neurite outgrowth

Authors - Yuqi Zhai
Loading...
||
New chat Able
正在加载,请稍候...