Cytohesin 3 Polyclonal antibody

• 

  WB analysis of human brain using 16687-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16687-1-AP (Cytohesin 3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16687-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16687-1-AP (Cytohesin 3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

Cytohesin 3 Polyclonal Antibody for WB, ELISA

Cat No. 16687-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CYTH3, ARF nucleotide-binding site opener 3, Cytohesin-3, Grp1, PH, SEC7 and coiled-coil domain-containing protein 3

---

Tested Applications

• Positive WB detected in: human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16687-1-AP targets Cytohesin 3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10025

  Product name: Recombinant human CYTH3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 221-399 aa of BC008191

  Sequence: MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK

• Full Name: cytohesin 3
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC008191
• Gene Symbol: Cytohesin 3
• Gene ID (NCBI): 9265
• RRID: AB_2261396
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43739
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytohesin 3 (CYTH3), also known as GRP1, ARNO3, or PSCD3, is a member of the PSCD family of guanine nucleotide exchange factors (GEFs) that regulate ADP-ribosylation factor (ARF) GTPases. Through its Sec7 domain, CYTH3 facilitates the exchange of GDP for GTP on ARF proteins, thereby modulating vesicle biogenesis, protein sorting, and Golgi apparatus structure and function. Clinicopathological studies demonstrate that CYTH3 is significantly upregulated in hepatocellular carcinoma (HCC) and negatively correlates with patient survival.