CYTL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYTL1 Polyclonal antibody (15856-1-AP)

CYTL1 Polyclonal Antibody for IHC, ELISA

Cat No. 15856-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

C17, C4orf4, CYTL1, cytokine like 1, Cytokine like protein 1, Protein C17

• 

  IHC staining of mouse lung using 15856-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 15856-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15856-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15856-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYTL1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: mouse lung tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15856-1-AP targets CYTL1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3977

  Product name: Recombinant human CYTL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC031391

  Sequence: MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

• Full Name: cytokine-like 1
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC031391
• Gene Symbol: CYTL1
• Gene ID (NCBI): 54360
• RRID: AB_2292620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRR1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CYTL1 Polyclonal antibody (Cat# 15856-1-AP) has 9 citations published in journals including Nature Communications, Frontiers in Immunology, Journal of Bone and Mineral Research, Cell Biosciences, Cells, International Journal of Molecular Sciences, Frontiers in Pharmacology, Scientific Reports, and JBMR Plus. Research fields span osteoarthritis, cartilage homeostasis, post-traumatic joint injury, gastric cancer, temporomandibular joint development, intervertebral disk degeneration, and type 1 diabetes.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; Dual functions of microRNA-17 in maintaining cartilage homeostasis and protection against osteoarthritis.; Authors - Yun Zhang
human	IHC	Front Immunol; A novel necroptosis-related gene index for predicting prognosis and a cold tumor immune microenvironment in stomach adenocarcinoma; Authors - Muhammad Khan
mouse	IF	J Bone Miner Res; LPS-induced Inflammation Prior to Injury Exacerbates the Development of Post-Traumatic Osteoarthritis in Mice.; Authors - Melanie E Mendez
human	IF	Cell Biosci; Single-cell RNA sequencing analysis of the temporomandibular joint condyle in 3 and 4-month-old human embryos; Authors - Qianqi Zhu
mouse	IF	Cells; Single-Cell RNA-Seq Reveals Transcriptomic Heterogeneity and Post-Traumatic Osteoarthritis-Associated Early Molecular Changes in Mouse Articular Chondrocytes.; Authors - Aimy Sebastian
mouse	IHC	Int J Mol Sci; Global Gene Expression Analysis Identifies Age-Related Differences in Knee Joint Transcriptome during the Development of Post-Traumatic Osteoarthritis in Mice.; Authors - Aimy Sebastian