Cadherin-19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cadherin-19 Polyclonal antibody, PBS Only (11473-1-PBS)

• 

  WB analysis using 11473-1-AP (same clone as 11473-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11473-1-AP (Cadherin-19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11473-1-PBS in a different storage buffer formulation.

Cadherin-19 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11473-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11473-1-PBS targets Cadherin-19 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2000

  Product name: Recombinant human CDH19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-390 aa of BC015877

  Sequence: MNTTSHHIGQLRSDLDNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNGTITTSNSLDREISAWYNLSITATEK

• Full Name: cadherin 19, type 2
• Calculated Molecular Weight: 55 kDa; 87 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC015877
• Gene Symbol: CDH19
• Gene ID (NCBI): 28513
• RRID: AB_3085374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H159
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.