Calcyon Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Calcyon Polyclonal antibody, PBS Only (13703-1-PBS)

• 

  IHC staining of human pituitary using 13703-1-AP (same clone as 13703-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 13703-1-AP (CALCYON antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13703-1-PBS in a different storage buffer formulation.

Calcyon Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 13703-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

13703-1-PBS targets Calcyon in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4622

  Product name: Recombinant human CALCYON protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC038978

  Sequence: MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

• Full Name: calcyon neuron-specific vesicular protein
• Calculated Molecular Weight: 217 aa, 23 kDa
• GenBank Accession Number: BC038978
• Gene Symbol: Calcyon
• Gene ID (NCBI): 50632
• RRID: AB_3085422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYX4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calcyon, also named as NSG3, DRD1IP and CALY, is a neuron-specific vesicular protein. It localizes to dendritic spines of D1 receptor-expressing pyramidal cells in prefrontal cortex.