Calpain 10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Calpain 10 Polyclonal antibody, PBS Only (10419-1-PBS)

• 

  WB analysis using 10419-1-AP (same clone as 10419-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10419-1-AP (Calpain 10 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10419-1-PBS in a different storage buffer formulation.

Calpain 10 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10419-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

10419-1-PBS targets Calpain 10 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0661

  Product name: Recombinant human CAPN10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 373-672 aa of BC004260

  Sequence: EPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAVGLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGEFLLRVFSTGRVSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPTNPCFPFSVPEGPGPRCVRITLHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPLLSCVPHRYAQEVSRLCLLPAGTYKVVPSTYLPDTEGAFTVTIATRIDRPSIHSQEMLGQFLQEVSVMAVMKT

• Full Name: calpain 10
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC004260
• Gene Symbol: CAPN10
• Gene ID (NCBI): 11132
• RRID: AB_2259529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HC96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.