Calpastatin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Calpastatin Polyclonal antibody, PBS Only (12250-1-PBS)

• 

  WB analysis of HeLa using 12250-1-AP (same clone as 12250-1-PBS)

  WB result of Calpastatin antibody (12250-1-AP; 1:120000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Calpastatin transfected HeLa cells. This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12250-1-AP (same clone as 12250-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12250-1-AP (Calpastatin antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 12250-1-AP (same clone as 12250-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 12250-1-AP (Calpastatin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12250-1-AP (same clone as 12250-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12250-1-AP (Calpastatin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 12250-1-AP (same clone as 12250-1-PBS)

  IP result of anti-Calpastatin (IP:12250-1-AP, 4ug; Detection:12250-1-AP 1:1000) with K-562 cells lysate 4000ug. This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12250-1-AP (same clone as 12250-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12250-1-AP (Calpastatin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12250-1-AP (same clone as 12250-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12250-1-AP (Calpastatin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12250-1-AP (same clone as 12250-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Calpastatin antibody (12250-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 12250-1-AP (same clone as 12250-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human Calpastatin (12250-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 12250-1-PBS in a different storage buffer formulation.

Calpastatin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 12250-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

CAST, Calpain inhibitor, Sperm BS-17 component

---

Product Information

12250-1-PBS targets Calpastatin in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2897

  Product name: Recombinant human CAST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC013579

  Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK

• Full Name: calpastatin
• Calculated Molecular Weight: 667 aa, 72 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC013579
• Gene Symbol: Calpastatin
• Gene ID (NCBI): 831
• RRID: AB_2071702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20810
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calpastatin (CAST) is an endogenous protein that specifically inhibits the activity of calpains, a family of calcium-dependent proteases involved in numerous cellular processes. The CAST gene encodes calpastatin, which contains multiple calpain-inhibiting domains that bind to the active site of calpain, preventing it from performing its functions. Calpastatin is found in the cytosol and plays a key role in regulating intracellular proteolysis, with malfunctions in the calpain-calpastatin system linked to various diseases, including autoimmune disorders and neurodegenerative conditions.