Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

calreticulin Polyclonal antibody

calreticulin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA

Cat No. 27298-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA

CALR, Calregulin, CRT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse skeletal muscle tissue, C6 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, SH-SY5Y cells
Positive IHC detected inhuman thyroid tissue, human colon tissue, human kidney tissue, mouse brain tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue
Positive IF-Fro detected inmouse kidney tissue
Positive IF/ICC detected inHepG2 cells, SKOV-3 cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27298-1-AP targets calreticulin in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26064

Product name: Recombinant human calreticulin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 248-417 aa of BC002500

Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Predict reactive species
Full Name calreticulin
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC002500
Gene Symbol Calreticulin
Gene ID (NCBI) 811
RRIDAB_2880835
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27797
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Protocols

Product Specific Protocols
FC protocol for calreticulin antibody 27298-1-APDownload protocol
IF protocol for calreticulin antibody 27298-1-APDownload protocol
IHC protocol for calreticulin antibody 27298-1-APDownload protocol
WB protocol for calreticulin antibody 27298-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Transient Receptor Potential V Channels Are Essential for Glucose Sensing by Aldolase and AMPK.

Authors - Mengqi Li
mouseIF

Nat Commun

In situ generation of micrometer-sized tumor cell-derived vesicles as autologous cancer vaccines for boosting systemic immune responses

Authors - Yuxin Guo
mouseIF

J Nanobiotechnology

Peptide-modified phase-transition nanoparticles co-deliver FTO siRNA and Ce6 for sonodynamic metabolism-immunotherapy of melanoma

Authors - Xintong Li
mouseIF

Nat Commun

Engineered macrophages as near-infrared light activated drug vectors for chemo-photodynamic therapy of primary and bone metastatic breast cancer.

Authors - Yanjuan Huang
humanWB

EMBO J

STING directly recruits WIPI2 for autophagosome formation during STING-induced autophagy

Authors - Wei Wan
mouse

J Control Release

Positron emission tomography guided synergistic treatment of melanoma using multifunctional zirconium-hematoporphyrin nanosonosensitizers

Authors - Xiaodan Jiao
Loading...
||
New chat

Able

正在加载,请稍候...