Cannabinoid receptor 1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cannabinoid receptor 1 Polyclonal antibody, PBS Only (29708-1-PBS)

• 

  WB analysis using 29708-1-AP (same clone as 29708-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29708-1-AP (Cannabinoid receptor 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29708-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29708-1-AP (same clone as 29708-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29708-1-AP (Cannabinoid receptor 1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29708-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29708-1-AP (same clone as 29708-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 29708-1-AP (Cannabinoid receptor 1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29708-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29708-1-AP (same clone as 29708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29708-1-AP (Cannabinoid receptor 1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29708-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29708-1-AP (same clone as 29708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29708-1-AP (Cannabinoid receptor 1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29708-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cannabinoid receptor 1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29708-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CNR1, CANN6, cannabinoid receptor 1 (brain), CB R, CB1

---

Product Information

29708-1-PBS targets Cannabinoid receptor 1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31838

  Product name: Recombinant human CNR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC074812

  Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCG

• Full Name: cannabinoid receptor 1 (brain)
• Calculated Molecular Weight: 472 aa, 53 kDa
• Observed Molecular Weight: 48 kDa, 66 kDa
• GenBank Accession Number: BC074812
• Gene Symbol: Cannabinoid receptor 1
• Gene ID (NCBI): 1268
• RRID: AB_2918340
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21554
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.