Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-17978 targets Cannabinoid receptor 1 in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12371 Product name: Recombinant human CNR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species |
| Full Name | cannabinoid receptor 1 (brain) |
| Calculated Molecular Weight | 472 aa, 53 kDa |
| Observed Molecular Weight | 45 kDa, 66 kDa |
| GenBank Accession Number | BC074812 |
| Gene Symbol | Cannabinoid receptor 1 |
| Gene ID (NCBI) | 1268 |
| RRID | AB_3084014 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21554 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Cannabinoid receptor 1 antibody CL488-17978 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

