CoraLite® Plus 488-conjugated Cannabinoid receptor 1 Polyclonal antibody

Cannabinoid receptor 1 Polyclonal Antibody for IF-P
Cat No. CL488-17978

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

CANN6, Cannabinoid receptor 1, cannabinoid receptor 1 (brain), CB R, CB1, CB1A, CB1K5, CB1R, CNR, CNR1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17978 targets Cannabinoid receptor 1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12371

Product name: Recombinant human CNR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-121 aa of BC074812

Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV

Predict reactive species
Full Name cannabinoid receptor 1 (brain)
Calculated Molecular Weight 472 aa, 53 kDa
Observed Molecular Weight45 kDa, 66 kDa
GenBank Accession NumberBC074812
Gene Symbol Cannabinoid receptor 1
Gene ID (NCBI) 1268
RRIDAB_3084014
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21554
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Cannabinoid receptor 1 antibody CL488-17978Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...