Tested Applications
| Positive WB detected in | MCF-7 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
29371-1-AP targets Cannabinoid receptor 2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30609 Product name: Recombinant human CNR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC074767 Sequence: MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLIL Predict reactive species |
| Full Name | cannabinoid receptor 2 (macrophage) |
| Calculated Molecular Weight | 360 aa, 40 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC074767 |
| Gene Symbol | Cannabinoid receptor 2 |
| Gene ID (NCBI) | 1269 |
| RRID | AB_2918285 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P34972 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Cannabinoid receptor 2 antibody 29371-1-AP | Download protocol |
| WB protocol for Cannabinoid receptor 2 antibody 29371-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
World J Gastroenterol Role of gut microbiota in Crohn's disease pathogenesis: Insights from fecal microbiota transplantation in mouse model | ||
J Inflamm Res Isoorientin Modulates Gut Microbes and Their Metabolites to Alleviate Caco-2 Cell Monolayer Inflammation by Reducing Intestinal Permeability via P-Gp/eCBs. | ||
J Tradit Complement Med Yinxieling attenuates psoriasis in mice by regulating oxidative stress and lipid mediators to correct immune cell disorder through the NF-κB/Nrf2 signaling pathways. |





