Product Information
26490-1-PBS targets Carbonic Anhydrase 6/CA6 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24207 Product name: Recombinant human CA6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-86 aa of BC034350 Sequence: QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHT Predict reactive species |
| Full Name | carbonic anhydrase VI |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC034350 |
| Gene Symbol | CA6 |
| Gene ID (NCBI) | 765 |
| RRID | AB_3742193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23280 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CA6 (Carbonic anhydrase VI) is a member of CA family proteins that play a central role in pH regulation and electrolyte balance (PMID: 15633208). CA6 is also known as gustin, is a zinc-containing secreted protein which catalyzes the hydration of carbon hydroxide in saliva (PMID: 19721466). CA6 is specifically expressed in the salivary gland of a number of mammalian species (PMID:28423504). The amino acid sequences are highly conserved across the species. And it was reported that decreasing of CA6 protein was associated with loss of taste and pathological morphology of taste buds (PMID: 9784398).
