Tested Applications
| Positive WB detected in | HeLa cells transfected with CRISPR-Cas9 , A431 cells transfected with CRISPR-Cas9 |
| Positive IP detected in | HeLa cells transfected with CRISPR-Cas9 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26758-1-AP targets Cas9 in WB, IP, ELISA applications and shows reactivity with bacteria samples.
| Tested Reactivity | bacteria |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25281 Product name: Recombinant Cas9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-100 aa of NP_269215 Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR Predict reactive species |
| Full Name | Cas9 |
| Calculated Molecular Weight | 160 kDa |
| GenBank Accession Number | NP_269215 |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_2918109 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99ZW2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9.
This antibody can recognize Cas9 protein with point mutations, such as dCas9 and nCas9.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for Cas9 antibody 26758-1-AP | Download protocol |
| WB protocol for Cas9 antibody 26758-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cas9 Polyclonal antibody (Cat# 26758-1-AP) has 9 total citations across journals including Nature, Autophagy, Advanced Science, Cell Death & Differentiation, Cell Communication and Signaling, Clinical Epigenetics, PLoS Pathogens, Blood Research, and Oncology Letters. Research fields span CRISPR/Cas9 gene editing, targeted protein degradation, prime editing, ferroptosis in hepatocellular carcinoma, viral restriction, pyroptosis in AML, and lung cancer therapeutics.
| Species | Application | Title |
|---|---|---|
Autophagy Advancing targeted protein degradation: pLIRTAC's role in glioma and CAR-T cell therapy. | ||
Adv Sci (Weinh) Enhancing Prime Editing Efficiency Through Modulation of Methylation on the Newly Synthesized DNA Strand and Prolonged Expression | ||
Cell Death Differ TRIM27-Cas9-loaded EVs suppress HCC proliferation and enhance responsiveness to anti-PD-1 therapy by promoting ACSL4-mediated ferroptosis | ||
Cell Commun Signal Whole-gene CRISPR/cas9 library screen revealed targeting STAT6 increased the sensitivity of liver cancer to celecoxib via inhibiting arachidonic acid shunting. | ||
Clin Epigenetics E2F1 combined with LINC01004 super-enhancer to promote hepatocellular carcinoma cell proliferation and metastasis |
Reviews
What customers say
One review (3/5 stars, July 2025) reports using this antibody for immunofluorescence on iPSC-derived cardiomyocytes at 1:400 dilution. The reviewer noted that the antibody is not validated for IF and, as expected, it did not produce a reliable signal. Overall, the single review suggests the antibody may not perform well in unvalidated applications like IF.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kiara (Verified Customer) (07-28-2025) | This primary antibody is not validated for IF, but I gave it a shot anyways. As expected, it did not give a reliable signal.
 |
