Caspr2/CNTNAP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Caspr2/CNTNAP2 Polyclonal antibody, PBS Only (25838-1-PBS)

• 

  WB analysis using 25838-1-AP (same clone as 25838-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25838-1-AP (Caspr2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25838-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 25838-1-AP (same clone as 25838-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25838-1-AP (Caspr2/CNTNAP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25838-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 25838-1-AP (same clone as 25838-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25838-1-AP (Caspr2/CNTNAP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25838-1-PBS in a different storage buffer formulation.

Caspr2/CNTNAP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25838-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

CNTNAP2, Caspr2, Contactin-associated protein-like 2

---

Product Information

25838-1-PBS targets Caspr2/CNTNAP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22844

  Product name: Recombinant human CNTNAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 982-1331 aa of BC113373

  Sequence: ERYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSSDTLFNSPKSLFLGKVIETGKIDQEIHKYNTPGFTGCLSRVQFNQIAPLKAALRQTNASAHVHIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI

• Full Name: contactin associated protein-like 2
• Calculated Molecular Weight: 1331 aa, 148 kDa
• Observed Molecular Weight: 148 kDa
• GenBank Accession Number: BC113373
• Gene Symbol: Grancalcin
• Gene ID (NCBI): 26047
• RRID: AB_2923575
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHC6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Caspr2 is a member of the neurexin family which functions in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, thrombospondin N-terminal-like domains and a putative PDZ binding site. This protein is localized at the juxtaparanodes of myelinated axons, and mediates interactions between neurons and glia during nervous system development and is also involved in localization of potassium channels within differentiating axons. This gene encompasses almost 1.5% of chromosome 7 and is one of the largest genes in the human genome. It is directly bound and regulated by forkhead box protein P2, a transcription factor related to speech and language development.