Caveolin-1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84044-1-RR (same clone as 84044-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84044-1-RR (Caveolin-1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84044-1-RR (same clone as 84044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84044-1-RR (Caveolin-1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84044-1-RR (same clone as 84044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84044-1-RR (Caveolin-1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung squamous cell carcinoma using 84044-1-RR (same clone as 84044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell carcinoma tissue slide using 84044-1-RR (Caveolin-1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84044-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84044-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84044-1-RR against Human Caveolin-1 were performed. The affinity constant is 1.53 nM.

Caveolin-1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84044-1-PBS

Clone No.240985E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Caveolin 1, CAV1, CGL3, CAV, BSCL3

---

Product Information

84044-1-PBS targets Caveolin-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8049

  Product name: Recombinant human Caveolin-1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 11-179 aa of BC006432

  Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

• Full Name: caveolin 1, caveolae protein, 22kDa
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC006432
• Gene Symbol: CAV1
• Gene ID (NCBI): 857
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q03135
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030).