Caveolin-3 Recombinant monoclonal antibody, PBS Only (Detector)

Caveolin-3 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85190-1-PBS
Clone No.242897B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

CAV3, Caveolin3, caveolin 3, LGMD1C, LQT9

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85190-1-PBS targets Caveolin-3 as part of a matched antibody pair:

MP01900-2: 85190-2-PBS capture and 85190-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28009

Product name: Recombinant human Caveolin-3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-40 aa of BC069368

Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVD

Predict reactive species
Full Name caveolin 3
Calculated Molecular Weight 151 aa, 17 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC069368
Gene Symbol Caveolin-3
Gene ID (NCBI) 859
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56539
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...