Cdc7 Kinase Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cdc7 Kinase Polyclonal antibody, PBS Only (17980-1-PBS)

• 

  WB analysis of SH-SY5Y using 17980-1-AP (same clone as 17980-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 17980-1-AP (Cdc7 Kinase antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17980-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17980-1-AP (same clone as 17980-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17980-1-AP (Cdc7 Kinase antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17980-1-AP (same clone as 17980-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using CDC7 antibody 17980-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 17980-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cdc7 Kinase Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17980-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17980-1-PBS targets Cdc7 Kinase in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12384

  Product name: Recombinant human CDC7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-349 aa of BC111044

  Sequence: MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASL

• Full Name: cell division cycle 7 homolog (S. cerevisiae)
• Calculated Molecular Weight: 574 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC111044
• Gene Symbol: CDC7
• Gene ID (NCBI): 8317
• RRID: AB_2291604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00311
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.