Centrin 2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Centrin 2 Recombinant monoclonal antibody (88406-1-RR)

Centrin 2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88406-1-RR

Clone No.260861B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CETN2, CALT, Caltractin isoform 1, CEN2, Centrin-2

• 

  WB analysis using 88406-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88406-1-RR (Centrin 2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88406-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88406-1-RR (Centrin 2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 88406-1-RR

  Mouse brain tissue lysates were subjected to SDS PAGE followed by western blot with 88406-1-RR (Centrin 2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue, HT-29 cells, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88406-1-RR targets Centrin 2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8638

  Product name: Recombinant human Centrin 2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC005334

  Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

• Full Name: centrin, EF-hand protein, 2
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005334
• Gene Symbol: Centrin 2
• Gene ID (NCBI): 1069
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41208
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Centrin 2 is also named as CALT, or CEN2. It plays a fundamental role in microtubule-organizing center structure and function. Oxidizing radiation induces polymerization of centrin 2 into dimers, tetramers, hexamers,and even higher molecular mass species, as a function of the radiation dose(PMID:17603931).It is specifically localized to the centrosome of interphase and mitotic cells in both HeLa and BHK cells (PMID:8248209).