Ch-TOG Polyclonal antibody

• 

  WB analysis of NCCIT using 26457-1-AP

  NCCIT cell were subjected to SDS PAGE followed by western blot with 26457-1-AP (Ch-TOG antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26457-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26457-1-AP (Ch-TOG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26457-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26457-1-AP (Ch-TOG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 26457-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 26457-1-AP (Ch-TOG antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 26457-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 26457-1-AP (Ch-TOG antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 26457-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Ch-TOG antibody (26457-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Ch-TOG Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26457-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CKAP5, ch TOG, Colonic and hepatic tumor overexpressed gene protein, Cytoskeleton-associated protein 5, TOGp

---

Tested Applications

• Positive WB detected in: HeLa cells, NCCIT cells, HepG2 cells, MCF-7 cells
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

26457-1-AP targets Ch-TOG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24875

  Product name: Recombinant human CKAP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC120869

  Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV

• Full Name: cytoskeleton associated protein 5
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: BC120869
• Gene Symbol: Ch-TOG
• Gene ID (NCBI): 9793
• RRID: AB_2880520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14008
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; Compartmentalized control of Cdk1 drives mitotic spindle assembly.; Authors - Angela Flavia Serpico
human	WB,IF	Clin Transl Med; Pathogenic variants of TUBB8 cause oocyte spindle defects by disrupting with EB1/CAKP5 interactions and potential treatment targeting microtubule acetylation through HDAC6 inhibition; Authors - Hui Luo