Chromogranin A Monoclonal antibody, PBS Only (Capture/Detector)

Chromogranin A Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 60135-2-PBS
Clone No.2A7D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

CGA, CHGA, 2A7D11, AL-11, Chromogranin-A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60135-2-PBS targets Chromogranin A as part of a matched antibody pair:

MP50241-2: 60135-2-PBS capture and 60135-3-PBS detection (validated in Cytometric bead array)

MP50241-3: 68851-1-PBS capture and 60135-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0807

Product name: Recombinant human CHGA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-457 aa of BC006459

Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Predict reactive species
Full Name chromogranin A (parathyroid secretory protein 1)
Calculated Molecular Weight 51 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC006459
Gene Symbol Chromogranin A
Gene ID (NCBI) 1113
RRIDAB_2918358
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10645
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.

Loading...
||
New chat

Able

正在加载,请稍候...