Claudin 5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Claudin 5 Polyclonal antibody (29999-1-AP)

• 

  WB analysis using 29999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29999-1-AP (Claudin 5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

Claudin 5 Polyclonal Antibody for WB, ELISA

Cat No. 29999-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CLDN5, AWAL, BEC1, Claudin5, Claudin-5

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29999-1-AP targets Claudin 5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29731

  Product name: Recombinant human CLDN5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC032363

  Sequence: MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGL

• Full Name: claudin 5
• Calculated Molecular Weight: 218 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC032363
• Gene Symbol: CLDN5
• Gene ID (NCBI): 7122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00501
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. Claudin-5 is a tight junction protein primarily expressed in endothelial cells, forming the blood-brain barrier. It regulates paracellular permeability and is crucial for vascular integrity. Altered expression is linked to blood-brain barrier disruption in neurological diseases and cancer metastasis.