Home
Products
Primary Antibodies
Claudin 7 Polyclonal antibody, PBS Only (29795-1-PBS)

Filter: AllWBIHCIF-P

WB analysis using 29795-1-AP (same clone as 29795-1-PBS)
Rat colon tissue was subjected to SDS PAGE followed by western blot with 29795-1-AP (Claudin 7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 29795-1-AP (same clone as 29795-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 29795-1-AP (Claudin 7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 29795-1-AP (same clone as 29795-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 29795-1-AP (Claudin 7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 29795-1-AP (same clone as 29795-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 29795-1-AP (Claudin 7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 29795-1-AP (same clone as 29795-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 29795-1-AP (Claudin 7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 29795-1-AP (same clone as 29795-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 29795-1-AP (Claudin 7 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 29795-1-AP (same clone as 29795-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 29795-1-AP (Claudin 7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 29795-1-AP (same clone as 29795-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Claudin 7 antibody (29795-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29795-1-PBS in a different storage buffer formulation.

Claudin 7 Polyclonal antibody, PBS Only

Name: Claudin 7 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 29795-1-PBS

Claudin 7 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 29795-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CEPTRL2, CLDN 7, CLDN7, CLDN-7, CPETRL2

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

29795-1-PBS targets Claudin 7 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag31706 Product name: Recombinant human CLDN7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 150-211 aa of BC001055 Sequence: NPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV Predict reactive species
Full Name	claudin 7
Calculated Molecular Weight	22.4 kDa
Observed Molecular Weight	23 kDa
GenBank Accession Number	BC001055
Gene Symbol	Claudin 7
Gene ID (NCBI)	1366
RRID	AB_2935481
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O95471
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm.