Clusterin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Clusterin Recombinant monoclonal antibody, PBS Only (84067-4-PBS)

Clusterin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84067-4-PBS

Clone No.241277D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

241277D4, AAG4, Aging-associated gene 4 protein, Apo J, APOJ

• 

  WB analysis of human plasma using 84067-4-RR (same clone as 84067-4-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 84067-4-RR (Clusterin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84067-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 84067-4-RR (same clone as 84067-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Clusterin antibody (84067-4-RR, Clone: 241277D4 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84067-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84067-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84067-4-RR against Human Clusterin were performed. The affinity constant is 6.91 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84067-4-PBS targets Clusterin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0225

  Product name: Recombinant Human CLU protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-449 aa of BC010514

  Sequence: DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• RRID: AB_3671635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10909
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874).