Tissue Factor/CD142 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00732-1

  Sandwich ELISA standard curve of MP00732-1, Human Coagulation Factor III/Tissue Factor Recombinant Matched Antibody Pair - PBS only. 83776-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1052. 83776-2-PBS was HRP conjugated as the detection antibody. Range: 7.8-500 pg/mL.

• 

  Sample test of MP00732-1

  The mean Coagulation Factor III/Tissue Factor concentration was determined to be 79.46 ng/mL in U-87 MG cell extract based on a 3.0 mg/mL extract load.

• 

  Sample test of MP00732-1

  Serum of sixteen individual healthy human donors was measured. The Coagulation Factor III/Tissue Factor concentration of detected samples was determined to be 44.3 pg/mL with a range of 8.4 - 122.7 pg/mL.

• 

  Cytometric bead array standard curve of MP00732-1

  Cytometric bead array standard curve of MP00732-1, Coagulation Factor III/Tissue Factor Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83776-1-PBS. Detection antibody: 83776-2-PBS. Standard: Eg1052. Range: 0.625-80 ng/mL.

Tissue Factor/CD142 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83776-2-PBS

Clone No.240784E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, TF

---

Product Information

83776-2-PBS targets Tissue Factor/CD142 as part of a matched antibody pair:

MP00732-1: 83776-1-PBS capture and 83776-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1052

  Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 33-251 aa of NM_001993.5

  Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 33 kDa
• GenBank Accession Number: NM_001993.5
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13726-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.