COL4A1 Polyclonal antibody

COL4A1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 30850-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

arresten, Collagen alpha 1(IV) chain, Collagen alpha-1(IV) chain, Collagen Type IV

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SK-N-SH cells
Positive IHC detected inHepatocellular carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 3 publications below

Product Information

30850-1-AP targets COL4A1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34391

Product name: Recombinant human COL4A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 901-1110 aa of BC151220

Sequence: LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGS

Predict reactive species
Full Name collagen, type IV, alpha 1
Calculated Molecular Weight 1669 aa, 161 kDa
Observed Molecular Weight160-220 kDa
GenBank Accession NumberBC151220
Gene Symbol COL4A1
Gene ID (NCBI) 1282
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP02462
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COL4A1 (Collagen Type IV Alpha 1 Chain) encodes a major component of type IV collagen, which is an essential structural element of basement membranes in various tissues. COL4A1 forms heterotrimers with other collagen type IV chains (e.g., COL4A2) and interacts with extracellular matrix components such as laminins, proteoglycans, and perlecans. Proteolytic cleavage of the non-collagenous domain of COL4A1 produces a fragment called arresten, which has anti-angiogenic and tumor suppressor properties. Elevated expression of COL4A1 has been observed in various cancers, including hepatocellular carcinoma (HCC), where it promotes tumor growth and metastasis through the FAK-Src signaling pathway. COL4A1 is highly expressed in various tissues, including the placenta, fat, and other organs. The expression of COL4A1 can be regulated by transcription factors such as RUNX1, which has been shown to upregulate COL4A1 in hepatocellular carcinoma. The molecular weight of OSBPL5 is 160 kDa, and it also has glycosylation modification.

Protocols

Product Specific Protocols
IHC protocol for COL4A1 antibody 30850-1-APDownload protocol
WB protocol for COL4A1 antibody 30850-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Sci Rep

Yiqi Juanshen decoction alleviates renal interstitial fibrosis by targeting the LOXL2/PI3K/AKT pathway to suppress EMT and inflammation

Authors - Kaiyue Tan
IHC

Sci Rep

Molecular mechanisms and therapeutic targets in glioblastoma multiforme: network and single-cell analyses

Authors - Xiangyu Chen
humanIHC

Discov Oncol

Hypoxia-mediated HES4 promotes the proliferation and motility of hepatocellular carcinoma cell by enhancing COL4A2 transcription

Authors - Pingping Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (01-13-2026)

detected a band around the calculated molecular weight

  • Applications: Western Blot
  • Cell Tissue Type: human
Loading...
||
New chat

Able

正在加载,请稍候...