Tested Applications
| Positive WB detected in | HeLa cells, SK-N-SH cells |
| Positive IHC detected in | Hepatocellular carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30850-1-AP targets COL4A1 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34391 Product name: Recombinant human COL4A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 901-1110 aa of BC151220 Sequence: LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGS Predict reactive species |
| Full Name | collagen, type IV, alpha 1 |
| Calculated Molecular Weight | 1669 aa, 161 kDa |
| Observed Molecular Weight | 160-220 kDa |
| GenBank Accession Number | BC151220 |
| Gene Symbol | COL4A1 |
| Gene ID (NCBI) | 1282 |
| RRID | AB_3742377 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P02462 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COL4A1 (Collagen Type IV Alpha 1 Chain) encodes a major component of type IV collagen, which is an essential structural element of basement membranes in various tissues. COL4A1 forms heterotrimers with other collagen type IV chains (e.g., COL4A2) and interacts with extracellular matrix components such as laminins, proteoglycans, and perlecans. Proteolytic cleavage of the non-collagenous domain of COL4A1 produces a fragment called arresten, which has anti-angiogenic and tumor suppressor properties. Elevated expression of COL4A1 has been observed in various cancers, including hepatocellular carcinoma (HCC), where it promotes tumor growth and metastasis through the FAK-Src signaling pathway. COL4A1 is highly expressed in various tissues, including the placenta, fat, and other organs. The expression of COL4A1 can be regulated by transcription factors such as RUNX1, which has been shown to upregulate COL4A1 in hepatocellular carcinoma. The molecular weight of OSBPL5 is 160 kDa, and it also has glycosylation modification.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COL4A1 antibody 30850-1-AP | Download protocol |
| WB protocol for COL4A1 antibody 30850-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COL4A1 Polyclonal antibody (Cat# 30850-1-AP) has 10 citations. They appear in journals including Advanced Science, Nature Communications, European Journal of Pharmacology, International Immunopharmacology, Scientific Reports (3), Cell Signaling, Functional & Integrative Genomics, and Discover Oncology. Research fields span fibrosis, diabetic nephropathy, glioblastoma, colorectal cancer, and hepatocellular carcinoma, with applications in WB and IHC.
| Species | Application | Title |
|---|---|---|
Eur J Pharmacol SIRT5 induces tubulointerstitial fibrosis via GLS1 in diabetic nephropathy. | ||
Int Immunopharmacol SIRT5 induces glomerular sclerosis in diabetic nephropathy through p53. | ||
Sci Rep AKAP12-LMOD1 signaling defines stromal CAF activation and epithelial junction loss in colorectal cancer. | ||
Sci Rep Yiqi Juanshen decoction alleviates renal interstitial fibrosis by targeting the LOXL2/PI3K/AKT pathway to suppress EMT and inflammation | ||
Sci Rep Molecular mechanisms and therapeutic targets in glioblastoma multiforme: network and single-cell analyses |
Reviews
What customers say
The single available review rates the product 5 out of 5 stars. The reviewer used it for Western Blot on human samples and reported detecting a band at the expected molecular weight, indicating reliable performance for this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (01-13-2026) | detected a band around the calculated molecular weight
|
