Collagen Type XV Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Collagen Type XV Polyclonal antibody (31056-1-AP)

• 

  WB analysis using 31056-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31056-1-AP (Collagen Type XV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

Collagen Type XV Polyclonal Antibody for WB, ELISA

Cat No. 31056-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

COL15, COL15A1, Collagen alpha 1(XV) chain, Collagen alpha-1(XV) chain, Collagen XV alpha 1

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31056-1-AP targets Collagen Type XV in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34644

  Product name: Recombinant human COL15A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-358 aa of BC157094

  Sequence: EEHSRIPFQRSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEGTLETTNMSIIQHSSPKQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLA

• Full Name: collagen, type XV, alpha 1
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC157094
• Gene Symbol: COL15A1
• Gene ID (NCBI): 1306
• RRID: AB_3742392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P39059
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.