Use Able AI chat for product recommendations

C5 Recombinant monoclonal antibody, PBS Only (Detector)

C5 Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86463-2-PBS
Clone No.251190G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

C5, C5a, C5, C5b, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, Complement C5, complement component 5

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86463-2-PBS targets C5 as part of a matched antibody pair:

MP02611-1: 86463-3-PBS capture and 86463-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4205

Product name: Recombinant Human Complement C5 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 678-751 aa of NM_001735.3

Sequence: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Predict reactive species
Full Name complement component 5
Calculated Molecular Weight188 kDa
GenBank Accession NumberNM_001735.3
Gene Symbol C5
Gene ID (NCBI) 727
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01031
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. This antibody specifically recognizes the C5 alpha chain.(PMID: 20010915; PMID: 8011297; PMID: 6554279)

Loading...
||
New chat

Able

正在加载,请稍候...