Complement Factor I Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Complement Factor I Recombinant monoclonal antibody (87109-1-RR)

• 

  WB analysis using 87109-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87109-1-RR (CFI antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

Complement Factor I Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87109-1-RR

Clone No.252199E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C3B/C4B inactivator, CFI, Complement factor I heavy chain, Complement factor I light chain, EC:3.4.21.45

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87109-1-RR targets Complement Factor I in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3066

  Product name: Recombinant Human Complement Factor I protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-583 aa of NM_000204.5

  Sequence: KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV

• Full Name: complement factor I
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: NM_000204.5
• Gene Symbol: CFI
• Gene ID (NCBI): 3426
• RRID: AB_3745346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05156
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement Factor I (CFI) protein is a key plasma serine protease, which is mainly synthesized in the liver, with a molecular weight of about 75-80 kDa, and circulates in the blood in the form of heterodimers of heavy chain (51 kDa)- light chain (37 kDa) disulfide bonds.