Mouse CXCL13/BCA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86564-1-RR (same clone as 86564-1-PBS)

  Non-transfected and Cxcl13-transfected HEK-293T cell lysates were subjected to SDS PAGE followed by western blot with 86564-1-RR (Cxcl13 antibody) at a dilution of 1:5000, incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86564-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 86564-1-RR (same clone as 86564-1-PBS)

  Mouse Cxcl13 Recombinant protein (cat no. Eg4484) were subjected to SDS PAGE followed by western blot with 86564-1-RR (Cxcl13 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 86564-1-RR (same clone as 86564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 86564-1-RR (CXCL13/BCA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 86564-1-RR (same clone as 86564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 86564-1-RR (CXCL13/BCA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86564-1-PBS in a different storage buffer formulation.

CXCL13/BCA1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86564-1-PBS

Clone No.250336E12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Cxcl13, B lymphocyte chemoattractant, BCA1, Blc, CXC chemokine BLC

---

Product Information

86564-1-PBS targets CXCL13/BCA1 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3331

  Product name: Recombinant Mouse Cxcl13 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-109 aa of NM_018866

  Sequence: ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA

• Full Name: chemokine (C-X-C motif) ligand 13
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: NM_018866
• Gene Symbol: Cxcl13
• Gene ID (NCBI): 55985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O55038
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CXCL13 (C-X-C motif chemokine 13), originally named B-lymphocyte chemoattractant (BLC) or B cell-attracting chemokine 1 (BCA-1), is a homeostatic chemokine that is constitutively secreted by stromal cells in the B-cell follicles of secondary lymphoid tissues (e.g., spleen, lymph nodes, tonsils, and Peyer's patches). It plays a crucial role in orchestrating cell migration within distinct regions of secondary lymphoid organs, strongly attracting B lymphocytes (and, to a lesser extent, T cells and macrophages) via its receptor CXCR5 (originally named Burkitt's lymphoma receptor 1, BLR1). In addition to maintaining immune cell trafficking and lymphoid follicle development, CXCL13 is implicated in inflammatory and autoimmune diseases (e.g., systemic lupus erythematosus, rheumatoid arthritis) and tumor progression (e.g., multiple myeloma).