Cyclin B1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85895-3-RR (same clone as 85895-3-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 85895-3-RR (CCNB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85895-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 85895-3-RR (same clone as 85895-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85895-3-RR (CCNB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85895-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85895-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85895-3-RR against Human Cyclin B1 were performed. The affinity constant is 2.70 nM.

Cyclin B1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85895-3-PBS

Clone No.250227C12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CCNB1, CCNB, Cyclin B, G2/mitotic specific cyclin B1, G2/mitotic-specific cyclin-B1

---

Product Information

85895-3-PBS targets Cyclin B1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29426

  Product name: Recombinant human CCNB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC006510

  Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE

• Full Name: cyclin B1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC006510
• Gene Symbol: Cyclin B1
• Gene ID (NCBI): 891
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14635
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.