Cyclin C Monoclonal antibody, PBS Only

• 

  WB analysis using 67415-1-Ig (same clone as 67415-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67415-1-Ig (Cyclin C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67415-1-PBS in a different storage buffer formulation.

Cyclin C Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67415-1-PBS

Clone No.4A4H2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CCNC, CycC, cyclin C, hSRB11, SRB11 homolog

---

Product Information

67415-1-PBS targets Cyclin C in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23955

  Product name: Recombinant human CCNC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-283 aa of BC056153

  Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

• Full Name: cyclin C
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC056153
• Gene Symbol: Cyclin C
• Gene ID (NCBI): 892
• RRID: AB_2882655
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24863
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.